PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12301s010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 119aa    MW: 13069.3 Da    PI: 3.9755
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12301s010.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS36.47.4e-1264116255
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55 
                      +++++cA+ +s++d ++a++ L +++e +s+ gdp++R+ +yf+eAL++rl+ 
  Csa12301s010.1  64 LKAIYNCAR-ISDSDPNEASKSLVQIRESVSELGDPTERVGFYFAEALSNRLSP 116
                     578999**9.8999*************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS509859.45737119IPR005202Transcription factor GRAS
PfamPF035142.6E-964116IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
YPSRLSSDLN NRVIDTSSPL PPPTLWPPSS PLSIPPHETT TTTTTATEDL ETNDSDFDLE  60
PPLLKAIYNC ARISDSDPNE ASKSLVQIRE SVSELGDPTE RVGFYFAEAL SNRLSPDYS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010444732.16e-76PREDICTED: scarecrow-like protein 4 isoform X1
RefseqXP_010444733.16e-76PREDICTED: scarecrow-like protein 4 isoform X2
SwissprotQ9FL033e-33SCL4_ARATH; Scarecrow-like protein 4
TrEMBLD7MLY44e-31D7MLY4_ARALL; Putative uncharacterized protein (Fragment)
STRINGAT5G66770.19e-31(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.11e-33GRAS family protein